PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01179.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 305aa    MW: 34324.5 Da    PI: 6.7975
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01179.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.4e-101141511954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   n+yps +++  LA+++gL+ +qV++WF N R +
  Rsa1.0_01179.1_g00006.1 114 FEHflNPYPSDADKHLLARQTGLSRNQVSNWFINARVR 151
                              665569******************************88 PP

2BELL68.71.1e-221433072
                     BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                             +q+v++sF++v+g+g+a pYt+lA+ka+SrhFrcLkdaia q+
  Rsa1.0_01179.1_g00006.1  1 MQMVVNSFDQVMGYGAAVPYTTLAQKAMSRHFRCLKDAIAVQL 43
                             9***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.7E-17140IPR006563POX domain
PROSITE profilePS5007112.8692155IPR001356Homeobox domain
CDDcd000866.89E-1395156No hitNo description
SMARTSM003891.1E-995159IPR001356Homeobox domain
SuperFamilySSF466893.76E-1896162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-2998161IPR009057Homeodomain-like
PfamPF059201.1E-18112151IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MQMVVNSFDQ VMGYGAAVPY TTLAQKAMSR HFRCLKDAIA VQLKHSCELL GDKESAGGAS  60
SGLTKGETPR LRLLEQSLRQ QRAFHHMGMM EQEAWRPQRG LPERSVNILR AWLFEHFLNP  120
YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMVEEM YQQEAKEREE EELGENKKED  180
YQQQRTHQQT NNRDTKPNES NFTLVQTITA QTPTTTMMTS TPHENDSSSL PPSTSVATAA  240
PLGVSGVFTV ATCQQDVSDF NVEDGVIRFG TKQAGDVSLT LGLRHTGNMP DNKSPSFSVR  300
DFGDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16101159563Homeobox protein Meis2
3k2a_B4e-16101159563Homeobox protein Meis2
4xrm_A4e-16101159563Homeobox protein Meis2
4xrm_B4e-16101159563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528110.0AK352811.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-02-J15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140492.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-158BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A078HQR50.0A0A078HQR5_BRANA; BnaA04g13860D protein
TrEMBLM4ETL50.0M4ETL5_BRARP; Uncharacterized protein
STRINGBra032147.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-131BEL1-like homeodomain 4